Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 4 - Jul 9
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD3 epsilon Fc Chimera Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CD3,T3e,CD3epsilon Accession Q95LI5 Amino Acid Sequence Gln22 Asp117, with C terminal Human IgG1 Fc
Product Specification
| Species | Cynomolgus |
| Synonyms | CD3,T3e,CD3epsilon |
| Accession | Q95LI5 |
| Amino Acid Sequence |
Gln22-Asp117, with C-terminal Human IgG1 Fc QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 37-43kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
CD3 has five kinds of peptide chains, namely γ chain, δ chain, ε chain, ζ chain and η chain, all of which are transmembrane proteins. The transmembrane region of CD3 molecule connects to the transmembrane region of two peptide chains of TCR through salt bridge, forming the TCR-CD3 complex, which is involved in nervous system development and positive regulation of cell adhesion. CD3 acts upstream of or within several processes, including positive regulation of T cell activation; positive regulation of cytokine production; and regulation of signal transduction.CD3 is located in several cellular components, including dendritic spine; external side of plasma membrane; and immunological synapse. Part of alpha-beta T cell receptor complex. CD3 is expressed in colon and hemolymphoid system.
Bispecific therapies targeting CD3, so-called T-cell engagers (TCE), belong to the new spectrum of anti-tumor immunotherapies stimulating T-lymphocytes. TCE are unique constructs targeting the MHC-independent CD3 epsilon subunit (CD3e) and a tumor antigen. Some TCE are in advances development, with promising results targeting CD20 and BSMA in lymphoma and myeloma. These successes have relaunched the development of TCE in solid tumors, bringing mixed results so far (notably in terms of tolerance). Still, TCE pave the way to new immunotherapy in tumors considered to be refractory to inhibitors of immune checkpoints such as prostate cancer or colorectal cancer.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy