Cholera Toxin B subunit (CTB)
SKU: 37337491362

Cholera Toxin B subunit (CTB)

Sale price$126.00 Regular price$140.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cholera Toxin B subunit (CTB)Product Specification Synonyms CHOLERA TOXIN B SUBUNITCTB Cholera Toxin B subunitCTxBCholeragenoid Accession P01556 Amino Acid Sequence MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN Expression System E. coli Molecular Weight 11. 8kDa(Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <0. 2EU g Conjugation Unconjugated Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris, 100mM

Product Specification


Synonyms CHOLERA TOXIN B SUBUNIT、CTB、 Cholera Toxin B subunit、CTxB、Choleragenoid
Accession P01556
Amino Acid Sequence

MTPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Expression System E.coli
Molecular Weight

11.8kDa(Reducing)

Purity >95% by SDS-PAGE & RP-HPLC
Endotoxin <0.2EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH9.0
Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Cholera toxin (CTB)belongs to the AB5 –subunit family oftoxins.The native hexameric protein has a molecular mass of ~85 kDa and contains two subunits. It consists of a single A subunit (~27.2 kDa), responsible for the ADP-ribosylation activity, and five B subunits(~11.6 kDa each), which are arranged as a pentameric ring with an apparent 5-fold symmetry and are associated with the cell surface receptor binding and subsequent internalization (transmembrane transport)of the enzymatic component.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 37337491362

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2047 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennifer M
Pawtucket, US
★★★★★ 5
My Designs? Sublime. The Paper? Sublimation Perfection.
Size: 8.5"X11"
Prints clear, presses clean, and never lets me down—unless I’m the problem (which is often). I keep this stocked like toilet paper. You don’t want to run out mid-project.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025
D
Verified Purchase
Denise Shiles
Fort Morgan, US
★★★★★ 5
Great Quality
Size: 8.5"X11"
This A-SUB sublimation paper is a great quality. I have been using it for many years and have had absolutely no issues. I use it with an Epson 2780 inkjet printer. I have never had a jamming issue or smudging.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
T
Verified Purchase
Tamara Hughley
Natrona Heights, US
★★★★★ 5
Happy to find a seller that carries the 120
Size: 8.5"X11"
I’ve been doing sublimation since May 2025. I have tried a variety between 105, 120 and 125. I’m not exactly sure why 120 ASub it is becoming harder to find . I absolutely love it. When I make my stainless steel tumblers, my colors pop more with 120.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
D
Verified Purchase
Dinusha
Birmingham, US
★★★★★ 4
Great Sublimation Paper – Perfect for Mugs
Size: 8.5"X11"
I purchased A-SUB Sublimation Paper 8.5x11 Inch 120GSM and I’m very happy with the results. The colors transfer beautifully. I used it for sublimation mugs and the print came out vibrant, sharp, and very professional-looking. No fading, no dull colors. I also tried using it for a cap, but the issue was not the paper — my cap heat press machine didn’t perform well and the transfer failed. For mugs, this paper works perfectly. Highly recommend for mug sublimation projects.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
M
Verified Purchase
Michael mariana
Los Angeles, US
★★★★★ 5
Craft paper
Size: 8.5"X11"
Good price!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026

recommand products