FGFR3[K650Q] Protein
SKU: 25804528546

FGFR3[K650Q] Protein

Sale price$345.15 Regular price$383.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGFR3[K650Q] ProteinProduct Specification Species Human Synonyms FGFR3[K650Q],FGFR3 Accession P22607 1 Amino Acid Sequence P436 T806(end)

Product Specification


Species Human
Synonyms FGFR3[K650Q],FGFR3
Accession P22607-1
Amino Acid Sequence

P436-T806(end)

PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKQTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Expression System Baculovirus-InsectCells
Molecular Weight 67.8 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, 0.05% Brij35, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25804528546

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 162 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
avalancheryder
Charlottesville, US
★★★★★ 5
Absolute game changer for chronically dry feet/cracked heels
Size: S (up to size 7)-Beige
I had recently bought a pair of silicone heel/ankle wraps to fill out my boot a little since I noticed my heels were lifting when I was skating. I tested them out around the house and noticed they left my heels softer while the rest of my sockless feet got quite dry. So I got these full foot silicone socks to see the effect of having my whole foot covered. I slather the entirety of my feet with Dr. Scholl's Severe Cracked Heel Restoring Balm (love how convenient it is to apply it to my feet with the solid stick form) and then slip them into these silicone socks. After just a couple hours, when I pull out my feet they're (a teeny bit sweaty at first), but then overall soft and smooth and have absorbed the balm fully leaving barely any residue in the silicone sock. I find these silicone socks generally comfortable; I wear them in the evenings while relaxing on the couch, take them off after a couple hours and let my feet breathe a bit, and then reapply my balm and socks and wear them to bed. If I wake up in the middle of the night, which I almost always do (not because of the socks), I'll take the socks off and allow my feet to breathe again. I wear a woman's size 6 shoe and the small size is pretty comfortable. However, I made the mistake of wearing them while being on my feet for a couple hours straight during household chores -- they must've somehow cut off my circulation a bit with the standing, so I wouldn't recommend wearing these silicone socks while being active. And since they're not exactly my foot size, they slide around sometimes and will start to feel tight at my big toe. But if that happens, I just tug on the toe area of the sock to give my big toe more wiggle room and problem solved. Prior to wearing these socks, I was soaking and doing heavy duty exfoliation of my feet every week. These socks seem like they'll work to help me extend the time between soakings and exfoliations. The 5 pack is a great value. So far none have torn, so they seem rather durable. Not sure what I could even do to tear a hole in these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2026
B
Verified Purchase
Beverly Durham
Boise, US
★★★★★ 5
Works wonders
Size: M (up to size 9)-Beige
Works wonders for dry feet, like really dry, hard feet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
T
Verified Purchase
Therapy by the Sea
New York, US
★★★★★ 4
EXCELLENT FEET MOISTURE PROTECTION
Size: S (up to size 7)-Beige, Size: S (up to size 7)-Beige
Why did you pick this product vs others?: I have burns on my feet and needed something that I could put burn creme on and still walk around in with. I tried other silicone footsie but they would teae really easily. So far these are doing really well for this purpose. They are holding their shape too. The only caution I have is the same with all silicone footsies: They can be slippery on wet floors, so also wear with socks over them. The biggest issues is when they say a size they mean it. The silicone used in these have little give in them, so they won't stretch out and loose their shape. That can be a good thing, or not so good, depending on how well they fit your feet and what your intent is with wearing these. The other issue is if they fit snug around those toes, that tends to be where the first tear in the material will happen. Because of how these are made, the tear is actually more like cracking in the material and once it occurs you won't be able to get much use out of the sock after that. If you are planning to wear them around the house or for long term use, I suggest going up a size or look for the toeless options.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2025
S
Verified Purchase
Shawna
Los Angeles, US
★★★★★ 3
Silicone socks
Size: M (up to size 9)-Beige
The socks are sized large. The quality of the silicone is good. But they slide around on your feet if you try to walk, making them difficult to use and a bit uncomfortable. Unless you are able to sit for long periods of time the likely will not work well. Recommend looking for a better value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2024
A
Verified Purchase
Ann
Draper, US
★★★★★ 5
Effective
Size: L (up to size 11)-Pink
Fantastic. I put lotion on my feet & wear them when I go to sleep. I often wake up during the night and will remove them to find my feet soft and smooth. They are strong and fit my size 10 womens’ size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026

recommand products