Human CGA, His tag
SKU: 9157598489

Human CGA, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CGA, His tagProduct Specification Species Human Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG alpha); Follicle stimulating hormone alpha chain (FSH alpha); Follitropin alpha chain Accession P08515 Amino Acid Sequence Protein sequence(P01215, Ala25 Ser116, with C 10*His)

Product Specification


Species Human
Synonyms Anterior putuitary glycoprotein hormones common subunit alpha; Choriogonadotropin alpha chain; Chorionic gonadotrophin subunit alpha (CG-alpha); Follicle-stimulating hormone alpha chain (FSH-alpha); Follitropin alpha chain
Accession P08515
Amino Acid Sequence

Protein sequence(P01215, Ala25-Ser116, with C-10*His)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.8kDa Actual: 25kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Glycoprotein hormones, alpha polypeptide is a protein that in humans is encoded by the CGA gene. The gonadotropin hormones, human chorionic gonadotropin, luteinizing hormone, follicle-stimulating hormone, and thyroid-stimulating hormone are heterodimers consisting of alpha and beta subunits that are associated non-covalently. The alpha subunits of these four human glycoprotein hormones are identical; however, their beta chains are unique and confer biological specificity. The protein encoded by this gene is the alpha subunit and belongs to the glycoprotein hormones alpha chain family.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9157598489

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 317 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amy Farrell
San Leandro, US
★★★★★ 5
Read this book! Then join our support group for the ending😜
While I’ve read some amazing books this year, it’s been awhile since I have completely devoured a book in less than 24 hours. This book was one I truly could not put down. I couldn’t fall asleep because I didn’t want to stop reading what happened next. The way this book starts is one of my absolute favorite ways to fall into a story - with no preamble and immediate conspiring amongst characters. Brynn has quickly become one of my new favorite FMCs. She is just so REAL. No whining or blaming her situation on everyone and everything else. She accepts her role in the world, but also holds a fierce determination to know the truth of that world. She is brave, yet terrified. Strong, yet self-conscious. She is cunning and intelligent and she doesn’t shy away from what is hard or allow emotion to overcome logic. I feel like she’s such a relatable character in everything that happens to her. Then we have Kai…our commander and son of the leader. He’s got secrets. Big ones. And the amount of times my feelings for him flipped in this book is insane. I’m still honestly reeling… Acker, my man…he’s mysterious, yet he doesn’t pull his punches. He’s loyal to a fault. He feels things deeply and he is fervent in his beliefs and desires. I adore him and yet want to shake him for the way he goes about making decisions and only sharing half truths. And right now my heart is aching for him and also terrified of him. When I say I need book 2 like I need water, that’s an understatement. I don’t have space to discuss every side character, but just know that I love them deeply and they each have big personalities of their own. The miscommunication honestly feels more like a necessity and less of a trope. The MCs don’t truly know one another, so of course there’s hesitancy to share everything with a stranger who has been somewhat forced upon you due to the situation you’ve both found yourself in. But it also is refreshing to watch them both learn to trust and communicate more and more as they go. The world building was exciting and unique - unlike anything I’ve read before. The kingdoms and their systems and the unique magics all create this setting that is utterly perfect. I never felt confused, but could easily envision everything as it was explained in detail. The slow burn and spice was paced so perfectly and realistically that it never felt weird or forced or annoying. It unfolds the way most normal relationships would (minus the magic and fantasy aspects). I truly cheered for our MCs and loved the way they finally came together. This story takes all the tropes we know and love and twists them into something unique and entirely different than all the other stories we’ve grown used to. And when I tell you that you will NEVER see the plot twists coming, HOLY SMOKES BATMAN! And the last 2 chapters took me ALL THE WAY OUT. I’m not sure how I’m supposed to be okay after that. I almost want to go back to chapter 55 and pretend the rest didn’t happen…but of course I can’t do that and now I’ll just be dying a little inside every day until I get my hands on book two! If you enjoy fantasy or romantasy, this has to be your next read. All the rest can wait. Grab your copy YESTERDAY.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
J
Verified Purchase
Jenniraereads
Whiting, US
★★★★★ 5
Outstanding book - A MUST READ
This is fantasy romance at its finest, and I couldn’t put it down from the moment I started. Packed with classic romantasy tropes that are done so well, especially my favorite: fated mates! The world-building is both easy to digest and detailed enough to feel immersive. It strikes the perfect balance—not too vague but never overwhelming. The world is divided between several groups of people, and the story revolves around the Alaha, who live on the water, and the Kenta, who reside on land. For centuries, these two factions have maintained a fragile peace, but things take a sharp turn when our FMC, Brynn, threatens that peace right at the beginning of the book. What follows is a thrilling dive into a world of magic, rebellion, and secrets. I will say no more, because you should go into this book relatively blind to get the full experience. Brynn, our FMC, is everything you could want in a lead. She’s smart, confident, and refuses to bow to threats. Then there’s the MMC, Acker. Scrumptious doesn’t even begin to cover it. The chemistry between him and Brynn is electric, and their dynamic had me grinning (and swooning) throughout. This book has all the best romantasy tropes: forced proximity, slowest of slow burns, elemental magic, fated mates (done right), political intrigue, and plot twists you will not see coming! Each trope is executed masterfully, blending seamlessly into the story without feeling overdone. If these are your jam, you’ll absolutely love this book. Even if they are not usually your cup of tea, this book may change your mind. While the pacing is fast and gripping overall, it does have a bit of a lull in the middle. That said, the ending more than made up for it—it left me gasping and desperate for the next book. I think I said aloud, “What the hell just happened?” when I finished the last page. This book grabbed me by the neck and didn’t let go. It’s full of banter, twisty turns, and a delicious tension. Probably one of my favorite fantasy reads this year. I am going to be thinking about this book non-stop until book 2 is released!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2024
N
Verified Purchase
Nicole Gassman
West Palm Beach, US
★★★★★ 4
Cool world building and great side characters
Format: Kindle
I adored the side characters and found them a lot more compelling than Jovie and Acker, if I’m being honest. I really wanted to like her but I found myself getting frustrated by her lack of, I don’t know, real rage for any of the crap people pull on her. Like ok I get this is romantasy but I have a hard time really believing you’re actually as upset at this guy as you claim to be when two minutes later you’re letting this dude shove his tongue down your throat. Additionally, an early running theme is that Jovie is frustrated that there are a bunch of people deciding things for her but the existence of the whole “matched/bond” thing makes much of her autonomy a moot point. Like at one point I think Acker even points out that them getting into bed together is a “foregone conclusion” and someone else mentions that the other matched pairs that don’t end up together ended up literally destroying each other. No pressure. I was a lot more interested in the characterization of Messer, Beau, and Hallis. I knew I was going to be exasperated consistently by this girl when she let Mr. Murder Hottie treat Messer like a war criminal after he almost got himself spatchcocked for them by a mighty-morphing radical with an attitude problem. If my homie went through the battle blender like that for me after I found out he had been secretly protecting me and keeping me company for weeks/months, I would be doing A LOT MORE than standing around trying to figure out if I actually thought he was my friend while Captain Boy Toy did some light torture on him. Also Acker, my dude, if you can still find it in your heart and your loins to get riled up while your sister is having a breakdown in the room over…I don’t know, seek help I guess. I liked the juxtaposition of Beau’s bravado and her militaristic delivery of information to her brother showing she can turn on a dime when needed. Adding the mental toll her gift takes on her throughout time and how she has self destructive coping mechanisms really gave her some cool depth, and I appreciated the vulnerability it lent her. Hallis was a weird character for me at first but I ended up looking forward to his dialogue a lot. Initially, I didn’t care for the way he seemed to immediately just be a real jerk to Jovie and it didn’t often read as playful to me when I think it sometimes meant to. Regardless, his genuine care for Beau and Acker and how he dropped the act immediately when they really needed him made him pretty endearing and I always appreciate a grump who cares. Honestly everything about this book was an A+ for me aside from the two main characters’ dynamic. When Jovie gets pissed at those bats and obliterates a forest? A+ When she tells Acker that she saw the signs that Messer was getting abused and acknowledged she felt shame and that she couldn’t fault him for being complicit in her mistreatment since she had done the same? A+ When she’s sitting there and coming to terms with the fact that everything she knows has been built on lies as she’s flipping through her sketchbook? A++ The writing and setting is great and the book is good, but someone needs to give Jovie a big stick and tell her it’s okay to be mad and smack people with it even if they’re hot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2025
D
Verified Purchase
Dimps
Lowell, US
★★★★★ 5
Mind blowing page turner
Oh my stars!!! 🤯 he falls first and he falls hard, enemies to lovers, fated mates. Every characters are lovable. There's action, magic, one horse 🤭 and a plot twist that keep on twisting. Oh and a bad ass FMC! Loved it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
B
Verified Purchase
Bryan & Lanae Kirby
Alexandria, US
★★★★★ 3
Interesting. Confusing ending that's too similar to another book
Ok, I had to process almost a whole 24 hours before I could write this review. And long story short, did I enjoy the book, yes. Does it have a lot of interesting and good parts to it? Also yes. But does it also have some major flaws? Absolutely. Now I'm not gonna break down every single little thing in this book. But here are the basics of what I liked, and what I didn't like. The good? I liked the characters. They intrigued me off the bad. The world building is pretty decent. It's a little confusing in the beginning, but information is slowly doled out, and some questions are answered. I found that there was a lot of little twists and turns that kept the story engaging. The magic system is intriguing. But, there are quite a few things off for me. First off, we have another story that has heavy inspirations from other books. There are a lot of aspects in this story that felt directly pulled from throne of glass. And the big twist at the end? Was almost verbatim the same ending as the book how does it feel. As soon as I read it I was like hold up, I literally just read almost this same thing when I read how does it feel when it released like a year or year and a half ago. Now I know no concepts are really new anymore, and inspiration comes for everywhere. But I feel like most stories it's like, oh this book has these vibes, or if you liked this book you'd like this one that's similar. But this reminds me of powerless in where there are like exact plots and plot points taken from other things. Now is that a bad thing? Not necessarily. I still enjoyed powerless, and I still enjoyed this story. But it does throw me. There are also a few red flags that the MMC Acker gave me that were not the good kind of red flags we love. First, when they are riding thru the city and people throw stuff at the FMC and he does nothing? Red flag. When they meet his dad and they demand she vows not only to the king but to the MMC? Red flag. All the secrets he keeps? Red flag. When he SLAPS HER IN THE END? Red flag. I'm not sure how I really feel about him. In the end. This was still an enjoyable read. I did like it and I am curious about the next book. But I am wary about some of the plot points and the MMC.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2024

recommand products