VHL His&AVI Tag Protein, Human
SKU: 90384198176

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 3 - Jul 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90384198176

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 1007 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
citizen fact checker
Battle Creek, US
★★★★★ 5
Very well researched, most informative and extremely well written.
Format: Hardcover
A talented writer, to say the least, Mr. Chernow seemed to research this remarkable book with the aim of painlessly educating even the most reluctant reader about an international banking family. He writes so well that this tome is a page turner: hard to put down, not the least boring even when the focus is on economics--the dismal science, as it is called--and helps one understand why many German Jews were heartbroken to leave Germany even during Hitler's regime. The Warburgs were an outstanding family with energy that seemed to know no bounds though some family members were stricken with diabetes, psychological illnesses and even poverty at times. Amazing! I highly recommend this wonderful book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2009
S
Verified Purchase
Spartan mom 2012
Dallas, US
★★★★★ 5
Unpacks Nazi rhetoric & makes it relevant to today
Format: Kindle
Ron Chernow’s best book ... unpacks Nazi rhetoric and makes it relevant to today. While I read his other books, honestly this book was far more impactful. I realized how little I knew about specific families and citizens in Germany during the rise of the Third Reich. While the Warburg family was extremely wealthy and atypical, they were very savvy yet still were very aligned to country which caused them to underestimate what was happening in Germany. I love to read about US leaders, but by reading this, realized I need to get out of US history and into global history. Also, while the Warburg brothers were the main focus, I appreciated focus and development of the important woman in the narrative.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2018
J
Verified Purchase
Jebo from Cali
Natrona Heights, US
★★★★★ 5
A Comprehensive Framework for Tackling Complexity with Confidence
Format: Kindle
Strategic Problem Solving is a powerhouse of a guide for anyone navigating today’s fast-paced, high-stakes business environment—or just dealing with tough challenges in general. Mark Hartley distills years of expertise into an actionable, easy-to-follow framework that makes complex decision-making feel manageable. The seven-step framework is the star of this book, offering a logical, systematic approach to breaking down big problems and creating solutions that stick. Each chapter walks readers through a specific phase of problem-solving, from defining the problem with precision to communicating and implementing solutions with clarity and impact. This isn’t just theory—every concept is illustrated with real-world examples, case studies, and practical tools like flowcharts and work plans. What makes this book stand out is its versatility. It’s perfect for professionals like executives, consultants, and managers, but the ideas can also apply to personal challenges. The tools for critical thinking, prioritization, and creative innovation feel universally relevant. Hartley’s writing is clear and concise, making even complex strategies approachable. One of my favorite aspects is the emphasis on real-world application. For example, the chapter on disaggregating problems compares tackling a challenge to scaling a mountain, encouraging readers to “break the mountain into hills.” It’s practical advice that sticks, and the accompanying tools like mind maps and timelines make it easy to translate into action. This book is more than just a manual for solving business problems—it’s a mindset shift. It helps you think critically, lead confidently, and make smarter decisions. Whether you’re managing a team, driving innovation, or simply trying to up your problem-solving game, this guide will be an invaluable resource. Highly recommended for leaders, thinkers, and anyone striving to navigate complexity with skill and precision!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2024
M
Verified Purchase
Matthew Shawn
Battle Creek, US
★★★★★ 5
Mastering Strategic Problem Solving
Format: Kindle
This book offers a comprehensive approach to tackling complex challenges through a practical, step-by-step framework. It guides readers in defining and breaking down problems, prioritizing for impact, and implementing solutions effectively. A notable strength is its emphasis on real-world application, featuring case studies and examples from diverse industries that demonstrate the framework in action. The chapter "Disaggregate the Problem into Smaller Pieces," for example, introduces the concept of disaggregation by comparing a complex problem to a towering mountain that becomes manageable when broken into smaller hills. This vivid metaphor, coupled with examples like successful product launches, illustrates how breaking challenges into components reduces cognitive load and sharpens focus. Tools such as mind mapping and flowcharts are explained in detail, enabling readers to visualize relationships and streamline decision-making processes. Aimed at consultants and aspiring professionals, this guide equips readers with the mindset and techniques to solve problems strategically. While insightful and well-structured, its academic tone may appeal more to professionals than casual readers. Nonetheless, its clear methodology and actionable exercises make it an excellent resource for anyone seeking to enhance their decision-making skills.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2024
P
Verified Purchase
PaladinPNW
Draper, US
★★★★★ 4
A very good and helpful book
Format: Kindle
This book provides a well-structured, step-by-step approach to tackling challenges effectively. The book outlines a seven-step process, beginning with defining and identifying the problem, and then walks the reader through practical techniques like mind mapping, prioritization, and overcoming decision paralysis. Further, one of the book’s strengths is its wealth of real-world examples and case studies, which make the concepts tangible. The discussion on managing time in problem-solving, critical thinking, and addressing communication barriers is particularly insightful. Additionally, Heartly introduces useful frameworks such as the "inner matrix" and role mapping, which help in breaking down complex problems into manageable parts. While the content is valuable, the writing can feel a bit wordy, and some sections could flow more smoothly. The references are also quite small (in the ebook), making them a bit difficult to read. However, these are minor drawbacks in an otherwise solid guide. Overall, this book is a great resource for anyone looking to enhance their problem-solving skills, whether in business, leadership, or personal decision-making.This book offers a clear, seven-step approach to tackling challenges. It provides practical tools like mind mapping, prioritization, and role mapping, with real-world case studies to illustrate key points. The book effectively covers critical thinking, time management, and communication barriers. While the writing can be wordy and the references small, the content is valuable. A solid resource for anyone looking to improve their problem-solving skills.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2025

recommand products