VHL His&AVI Tag Protein, Human
SKU: 96976910355

VHL His&AVI Tag Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 3 - Jul 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

VHL His&AVI Tag Protein, HumanProduct Specification Species Human Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human Amino Acid Sequence Met1 Asp213, with N terminal His SUMO & C terminal AVI Tag

Product Specification


Species Human
Synonyms HRCA1 Protein, Human; pVHL Protein, Human; RCA1 Protein, Human; VHL1 Protein, Human
Amino Acid Sequence

Met1-Asp213, with N-terminal His SUMO & C-terminal AVI Tag

MGSSHHHHHHSSGLVPRGSHMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGMPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGDGLNDIFEAQKIEWHE

Expression System E.coli
Molecular Weight 45 kDa
Purity

>85% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 20 mM PB,100 mM KCl,0.1 mM EDTA ,2 mM DTT, pH 7.5
Reconstitution A hardcopy of datasheet with reconstitution instructions is sent along with the products. Please refer to it for detailed information.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96976910355

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 368 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Seth Walton
Omaha, US
★★★★★ 4
great case!
Color: Navy Blue
pros; the color is beautiful. I picked the navy blue. It is exactly as the description described. It goes very well with my blue iPad. The size is very precise and fits perfectly on my iPad. The magnet that holds the case together is very strong. The iPad itself can pivot vertically and horizontally using that magnet. This works very smooth. The magnet closure for the case itself is strong and holds well. The magnet that holds the keyboard in place also works very well. Cons; when the keyboard is in its correct position, it is difficult to angle the iPad in front into the provided grooves. The keyboard gets into the way. This prevents the iPad from reaching the grooves provided. The keyboard feels very light and cheap. The keyboard itself connected with the Bluetooth very easily. It works wonderful. I love the back light on the keyboard. The color of the keyboard is wonderful. However, as I said above, it does feel a bit cheap. But for 20 bucks, what can you ask for. When the case is folded together with the keyboard in the iPad, it is a bit bulky. But I knew that from the previous reviews and was expecting it. What I love most about this case is that the iPad can be removed using the magnet on the back from the keyboard portion, but it is still protected by the exterior plastic case. So in situations where I don’t need to use my keyboard, I can remove the iPad itself and know that it’s still protected overall I recommend this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
A
Verified Purchase
Amazon Customer
Whiting, US
★★★★★ 5
Nice Case & Keyboard
Color: Blue
Love this case with a keyboard. I like using the keyboard vs using one on the screen of iPad. And the keyboard has rechargeable batteries instead of having to buy batteries. And it protects my iPad.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
E
Verified Purchase
Eli Beltran
Lowell, US
★★★★★ 1
Beautiful, and everything I want it except that the keyboard keys didn’t work😭
Color: Light Pink
I searched and search for the right keyboard case for me. The most important thing for me was to be able to remove the iPad case itself from the whole case and keyboard, and this one was it. Unfortunately, when I started checking the keyboard a lot of The keys were not output in the correct symbol or letters. So defeats the whole purpose of having a keyboard. I returned it and asked for a replacement, thinking that the item was defected, but when I got the New replacement, it was the same thing so I tried to contact the seller, but there was no option to do that. Therefore, I had to return the second replacement keyboard and look for another keyboard cover.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
K
Verified Purchase
Kat
Massapequa, US
★★★★★ 5
Great quality case and keyboard
Color: Purple, Color: Purple
Super good quality case, I was actually surprised since it’s such a good price. It fit my 10.9 inch perfectly! Keyboard has magnetic attachment to the case which is super handy, and it connected with Bluetooth seamlessly. Keyboard isn’t silent, it’s on the louder side, but not too loud at all and it doesn’t bother me at all because I prefer clickier keyboards. Oh also something that’s really cool is that you can change the colors of the keyboard, love that!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
U
Verified Purchase
User123456
Los Angeles, US
★★★★★ 5
Amazing!
Color: Midnight Green
The Hamile Keyboard Case for iPad (11th & 10th Generation) is a practical accessory for turning your iPad into a more laptop-like setup. Designed with a detachable wireless keyboard and protective case, it’s aimed at students, professionals, and anyone who types frequently on their tablet. One of its most appealing features is the 7-color backlit keyboard, which makes typing easier in low-light environments while also adding a customizable, stylish look. The backlighting can usually be adjusted in brightness and color, making it both functional and fun to use. The keys are generally responsive and comfortable enough for everyday typing tasks like emails, notes, and document work. The case itself provides decent protection for the iPad, helping guard against scratches and minor bumps. It also holds the tablet at a stable viewing angle, which is useful for video calls, studying, or streaming. The wireless connection is typically simple to set up via Bluetooth, and the keyboard can be detached when not needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026

recommand products