
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 4 - Jul 9
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD14, His tagProduct Specification Species Human Synonyms Myeloid cell specific leucine rich glycoprotein Accession P08571 Amino Acid Sequence Protein sequence(P08571, Thr20 Met344, with C 10*His)
Product Specification
| Species | Human |
| Synonyms | Myeloid cell-specific leucine-rich glycoprotein |
| Accession | P08571 |
| Amino Acid Sequence | Protein sequence(P08571, Thr20-Met344, with C-10*His) TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:36.7kDa Actual:50-55kDa |
| Purity | >90% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD14 (cluster of differentiation 14) is a human protein made mostly by macrophages as part of the innate immune system. It helps to detect bacteria in the body by binding lipopolysaccharide (LPS), a pathogen-associated molecular pattern (PAMP). CD14 acts as a co-receptor (along with the Toll-like receptor TLR 4 and MD-2) for the detection of bacterial lipopolysaccharide (LPS). CD14 can bind LPS only in the presence of lipopolysaccharide-binding protein (LBP). Although LPS is considered its main ligand, CD14 also recognizes other pathogen-associated molecular patterns such as lipoteichoic acid.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 1474 reviews
Sort
Product Reviews
★★★★★ 5
Rugged, Stylish, and Built to Last
Style: Bi-fold
I bought this Carhartt oil-tan leather wallet for my husband, and it’s exactly what I hoped for. The leather feels thick and high quality, with that classic rugged Carhartt look. The stitching is solid, and it’s clear this wallet will hold up for years of daily use.
It has plenty of card slots and an ID window, but still stays slim enough to fit comfortably in a back pocket. The canvas lining is a nice touch, and the embossed Carhartt logo adds just the right amount of style.
It even came packaged in a collectible tin, which made it perfect for gifting. Highly recommend to anyone who wants a durable, functional, and great-looking wallet!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2025
★★★★★ 5
Great quality, classic and durable wallet
Style: Bi-fold
I bought this wallet for my husband, and he’s been really happy with it. The leather feels high quality, and the wallet has a clean, stylish look that isn’t bulky.
It seems very well made and durable, and it feels like it will last a long time with everyday use. The size is practical, and everything fits comfortably without being too thick. Overall, this was a great purchase and would make a nice gift.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
★★★★★ 5
Excellent Wallet — Stylish, Durable, and Practical!
Style: Front Pocket
I absolutely love this wallet. The quality is impressive — the material feels durable, the stitching is solid, and it has a sleek, modern look. It has plenty of space for cards, cash, and IDs without feeling bulky, which is a huge plus. Everything fits securely, and it’s easy to access what I need.
Overall, this wallet is a perfect mix of style and functionality. Highly recommended for anyone looking for something reliable and well-made!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2025
★★★★★ 4
Great wallet, no RFID BLOCK
Style: Front Pocket
Well made good looking wallet lots of space and the magnetic cash retention is really strong. The RFID block doesn’t work at all, I put a security access card in multiple places in the wallet and it can read it from 4 inches away like it’s not even in a wallet. Great product just don’t expect good security coverage. Front pocket so harder for a bad actor to scan without you noticing but risk still there.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
★★★★★ 5
It’s everything that is advertised.
Style: Front Pocket
It’s exactly as pictured. Bought it for my son. He loves it! Great quality leather. But, that Carhartt. Exceptional quality. Love the magnetic clip for cash. He’s a high school student. Now his ID, gifts cards , and cash are all centrally located. Instead of his pockets. Worth every penny! He wants me to order another one in case someone steals it. All his friends want one! Won’t let me give it 5 stars
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026