Human Geminin , His tag
SKU: 35152705855

Human Geminin , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Geminin , His tagProduct Specification Species Human Synonyms GMNN Accession O75496 Amino Acid Sequence Protein sequence(O75496, Leu110 Ile209, with C 10*His) MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Theoretical: 13. 1kDa Actual: 19kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized

Product Specification


Species Human
Synonyms GMNN
Accession O75496
Amino Acid Sequence

Protein sequence(O75496, Leu110-Ile209, with C-10*His)
MLYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCIGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical:13.1kDa Actual:19kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Geminin is a nuclear protein present in most eukaryotes and highly conserved across species, numerous functions have been elucidated for geminin including roles in metazoan cell cycle, cellular proliferation, cell lineage commitment, and neural differentiation. One example of its function is the inhibition of Cdt1. Geminin has been found to be overexpressed in several malignancies and cancer cell lines, while there is data demonstrating that geminin acts as a tumor suppressor by safeguarding genome stability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35152705855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 2123 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
lizzagn
Lake Worth, US
★★★★★ 5
Quality tallow in a giant container for an amazing price that doesn't bother my severe allergies!
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
I have been using this product for 3 months and I love it! It is a thick consistency, like you would expect good quality tallow. It feels great on your skin and absorbs fairly quickly. It is a large size jar for the price, I still have over half left and I have used it on my neck and hands as well... sometimes on my legs. I am allergic to artificial fragrance, and this tallow does not bother me. The scent is pleasant, with a slight after-smell of tallow, but it is not unappealing. It is very moisturizing for many parts of the body, but I especially like it for my face and neck. My skin truly has a better glow and tone after using the product for a few months. I can't wait to see how great it will feel at the end of the jar!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
R
Verified Purchase
Roel Y.
Natrona Heights, US
★★★★★ 5
Great product
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
Great value for the size. Easy to apply and absorbs quickly wherever you apply it. Does not leave any oily residue and it smells fragrant. Moisturizes and works quickly. Skin feels instantly smooth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
DLW
Draper, US
★★★★★ 5
This product is da' BALM! (a softening balm that's the best moisturizer for all skin types!)
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
So many of these are all over social media and I wasn't sure to order a whipped version, or just a balm, so I went with the balm and I'm totally satisfied. No breakouts to my sensitive, mature dry skin, and the scent is light citrus and non-lingering. I suggest to lightly swirl finger tips inside the container in a circular motion and scoop a tiny amount then rub both fingertips together to warm the product as this is key to make it glide smoothly onto your skin, otherwise, you are having to re-dip into the product and use more than you will need. I use it AM/PM right after my facial serums, and follow with SPF moisturizer. I'm not a fan of foundation or powder to avoid the caked on look, but use a little creme blush when heading to work, and will dab a little concealer where needed too. I've been using my Ancestral Haven Beef Tallow/Honey Balm a couple of weeks now and my pores seem smaller than when using any of my previous French pricey skin products! I use this on my face and lightly under eyes, neck, decollete and the heels/sides of my feet every morning. Any remaining product I apply to top my hands. It absorbs quickly without being greasy. If you experience an oily result, then lighten your next application as the product is light if you don't warm it up with your fingertips. I highly recommend and can't wait to tell my dermatologist about it too! Oh and my 86 years young mom uses this daily and loves it too! (Christmas gifts coming her way so she doesn't deplete my supply - lol).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
A
Verified Purchase
Amy
Chelsea, US
★★★★★ 5
Tried 100’s of product and this is all my son lets me use on him willingly!
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
The ONLY product I can put on my child’s eczema and allergy problematic skin and not irritate his skin. My son has TERRIBLE SKIN that is EXTREMELY sensitive and to top that off, he also picks at his scabs. This is the only product I’ve ever been able to use on him and use up the entire product because he doesn’t breakout in a rash, it doesn’t sting his skin in even the worst of areas that are freshly picked scabs, and that’s a huge deal for us! It is extremely moisturizing and although slightly greasy, it’s a much better feeling on the skin then what you get from a Aquaphor or petroleum jelly. That and my son absolutely cannot stand the texture of Aquaphor and petroleum jelly, but with the tallow, he doesn’t hardly say a word as long as I don’t put it on too thick. This can be layered for extra protection in problem areas, or worked into the skin and absorbs quite nicely and feels fantastic! It has a very mild scent that I truly love, but the scent doesn’t really travel outside the jar so you know it’s very minimal. After the hundreds of products that I’ve tried and the thousands of dollars wasted over the years, I will continue to purchase this as my holy grail for my son’s extremely sensitive skin condition. Thank you so much!!!! And I will upload pictures of before and after so be sure to see how well it’s healed his skin within a week of use!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
T
Verified Purchase
Tonia Le Vangie
Port Orchard, US
★★★★★ 4
Good product.
Scent: Honey & Sweet Orange, Size: 5 Ounce (Pack of 1)
Seems to work great, but time will tell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026

recommand products