Human IgG1 Fc , His tag
SKU: 28822163923

Human IgG1 Fc , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG1 Fc , His tagProduct Specification Species Human Synonyms Immunoglobulin heavy constant gamma 1, Ig gamma 1 chain C region, Ig gamma 1 chain C region EU, Ig gamma 1 chain C region KOL, Ig gamma 1 chain C region NIE, IGHG1 Accession P01857 Amino Acid Sequence Protein sequence(P01857, Asp104 Lys330(D239E,L241E), with C 10*His)

Product Specification


Species Human
Synonyms Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1
Accession P01857
Amino Acid Sequence Protein sequence(P01857, Asp104-Lys330(D239E,L241E), with C-10*His) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.2kDa Actual:30kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28822163923

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1011 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Q
Verified Purchase
QnP Atkinson
West Palm Beach, US
★★★★★ 5
Very gentle, yet effective
Size: 25 Count (Pack of 1)
These are a great bang for your buck! My daughter struggles with her sensitive skin. These make up wipes are so soft and feels like a gentle clothe. No obnoxious smells, and resealable. Perfect for traveling. Her skin feels great after wiping off the most stubborn water proof make up. The price makes it a no brainer!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2025
S
Verified Purchase
Sparky
Waukegan, US
★★★★★ 5
Gentle but very effective in removing all types of makeup
Size: 25 Count (Pack of 1)
I had been using a different brand of make up remover towelettes for years until one day I opened up a new pack and my eyes swelled up and my skin looked burned around my eyes . A waited a few days & tried it again and same thing - only worse . It seems that the manufacturer changed the formula ( why manufacturers insist on fixing something when it’s not broken is beyond me ). Anyway , I googled and read up on all kinds of make up remover towelets and took note that the Simple Kind to Skin seemed to have the best reviews . I tried them and have been using them ever since . They are non greasy which I love , extremely gentle on the skin but excellent on removing makeup even stubborn waterproof mascara . And they don’t dry out your skin . Good product . Note to manufacturer : please do not EVER change this formula .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2018
M
Verified Purchase
Margaret A. Crisalli
Chelsea, US
★★★★★ 5
Good face wipes
Size: 1 Count (Pack of 2)
Nothing left out of description
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
D
Verified Purchase
Debbie Murphy
Port Orchard, US
★★★★★ 5
Eye makeup remover pads.
Very convenient for traveling! No bottles to mess with and they work very well at removing eye makeup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
S
Verified Purchase
Susan M
Draper, US
★★★★★ 5
Great makeup remover pads - ILove them!!
These pads are wonderful. I have used them for many years and love them. They do not irritate my skin but are strong enough to remove eye makeup with no problems.,.ever. Am so glad I found some many years ago and will us for The rest of my Life.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2024

recommand products