ST6/CD82 His Tag Protein, Human
SKU: 65118684993

ST6/CD82 His Tag Protein, Human

Sale price$356.40 Regular price$396.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ST6/CD82 His Tag Protein, HumanProduct Specification Species Human Antigen ST6 CD82 Synonyms KAI1, SAR2, TSPAN27 Accession P27701 1 Amino Acid Sequence Gly111 Leu228, with C terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 30kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Antigen ST6/CD82
Synonyms KAI1, SAR2, TSPAN27
Accession P27701-1
Amino Acid Sequence

Gly111-Leu228, with C-terminal 8*His Tag GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-30kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6.

Background

KAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65118684993

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1935 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Evan J.
Grantham, US
★★★★★ 5
The only toy my dogs can’t destroy and love
Color: Onyx Black - Most Durable
I am thrilled to have found one toy my dogs don’t destroy immediately. They have torn up Fenrir hammers, the black kongs of all sizes, the monster k9 stick, nylabones, and they don’t like the goughnut at all (it stinks like a bad tire). This is the first one they both love and haven’t been able to destroy immediately. It does allow little tooth marks, but that’s what makes it fun for them. They are very happy playing with it and I’d say this one was worth every dollar. Update Months Later: We’ve gone through 2/3 now. I got two initially, and one has lasted long term. They still haven’t completely destroyed it. They did destroy a second one quickly so I suspect a flaw in it. They sent me a new one and they took a while, but they did destroy the third to the point we had to throw it away. Despite that, one still remains and our dogs still love it. It’s still the best for the money compared to others. We have two Bully XL’s that are each close to 100 pounds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2024
M
Verified Purchase
M. B.
New York, US
★★★★★ 5
Indestructible
Color: Onyx Black - Most Durable
This is actually indestrutible! Be careful though, it's wicked hard/heavy. It isn't a ball you want banging into things. Use outside!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
L
Verified Purchase
Lauren
Grantham, US
★★★★★ 4
Not indestructible, but the best I’ve found
Color: Onyx Black - Most Durable, Color: Onyx Black - Most Durable
This thing is unexpectedly heavy for its size. My 18 month old Giant Schnauzer is obsessed with fetch but destroys every ball she gets. The other brands marketed for extreme chewers tend to last about a day or two before they’re totally shredded. She’s had this one for about 2 weeks and it’s looking rough, but still holding together for the most part. I appreciate that as it comes apart it does so in little pieces rather than large chunks. While it’s far from indestructible, it’s the strongest I’ve found so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
R
Verified Purchase
Ryan
New York, US
★★★★★ 5
Great product!
Color: Onyx Black - Most Durable
Great product! Quickly became my Pit Princess's favorite toy! The size, weight, and material is perfect for a big dog. Now we have fetch ball that has proven itself to be worthy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
B
Verified Purchase
Bill Jackson
Birmingham, US
★★★★★ 3
good but not indestructible
Color: Onyx Black - Most Durable, Color: Onyx Black - Most Durable
pretty good but definitely not indestructible
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026

recommand products