Human CD235a , His tag
SKU: 27536910523

Human CD235a , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD235a , His tagProduct Specification Species Human Synonyms Glycophorin A, MN sialoglycoprotein, PAS 2, Sialoglycoprotein alpha, GYPA, GPA Accession P02724 Amino Acid Sequence Protein sequence(P02724, Ser20 Glu91, with C 10*His) SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 9. 6kDa Actual: 15 20, 40 70kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Glycophorin-A, MN sialoglycoprotein, PAS-2, Sialoglycoprotein alpha, GYPA, GPA
Accession P02724
Amino Acid Sequence

Protein sequence(P02724, Ser20-Glu91, with C-10*His)

SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:9.6kDa Actual:15-20, 40-70kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Glycophorin A (MNS blood group), also known as GYPA, is a protein which in humans is encoded by the GYPA gene. GYPA has also recently been designated CD235a (cluster of differentiation 235a). Glycophorins A (GYPA; this protein) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens, that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta; also, Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27536910523

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1364 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
William Prince
Grantham, US
★★★★★ 5
Woollacott has done an amazing job of beginning to document the nature of the ...
Format: Hardcover
Ms. Woollacott has done an amazing job of beginning to document the nature of the conscious substrate that forms the very foundation of our existence, and she does so in a scientifically responsible fashion. An endeavor of this nature by a professional scientist takes not a small amount of courage because this is a topic that is ignored and often ridiculed by many mainstream scientists. The fact that we have attained a large body of evidence that points ineluctably to the reality of non-corporeal consciousness in the universe is enough to warrant serious investigations into this phenomenon, and hopefully this erudite work and others like it will spur further scholarly investigations into this subject of overarching importance. As an added bonus this book is a thoroughly enjoyable and stimulating read; it's hard to put down once you start reading. This is must read for all people who are curious about the ultimate nature of their being, and by all rights that should include everyone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2016
H
Verified Purchase
Howard Schumann
Grantham, US
★★★★★ 5
Logical, Coherent, and Inspiring
Format: Hardcover
I have read an infinite number of books on the nature of reality and our spiritual nature and I don't hold back in saying that "Infinite Awareness" is one of the best. Ms. Woollacott's book is logical, coherent, and inspiring. It can be challenging but it is 100% beyond many New Age tropes. While the book does repeat several well known NDEs and again discusses Ian Stevenson's studies on reincarnation, it is always with a fresh approach. In addition, this is one of the very few books that discusses our power to create our own reality through intention. Though not mentioned in the book, to me it is a tribute to the groundbreaking work of Werner Erhard and the Est Training of the 1970s.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2017
P
Verified Purchase
PK1950
West Palm Beach, US
★★★★★ 5
The book's title says it all - Highly recommended
Format: Hardcover
A very interesting read of a scientist (a neuroscientist) who began as a nonbeliever in anything outside of empirical, mainstream science. Her encounters with patients near death experiences (NDEs) during surgery slowly convinced her otherwise. She also had read Ian Stevenson's seminal work on reincarnation (published in the 1960s), and Raymond Moody's book (Published in the 1970s) on NDEs. She also came to believe that reincarnation and the spiritual realm are real, not fiction. Our earthly science is very far from understanding these aspects of reality. Scientists can't even explain consciousness An excellent read. highly recommended..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2016
L
Verified Purchase
Lorraine Haataia, PhD
Massapequa, US
★★★★★ 5
A guidebook for escaping the rat race
Format: Kindle
This book provides a completely new way of looking at your job and potential residual income. It's a guide to help you shift your focus to your residual income which can set you free. Our school system teaches kids that, until they're in their late teens or early 20s, they're going to spend their days in school and college. These habits of showing up and punching the clock (via attendance) are so ingrained by this point in life that few question whether there's another realistic option. And adults go into jobs that perpetuate this cycle of clocking in early in the morning and checking out late in the evening. Timothy Ferris shows that it is indeed possible to escape this rat race. He shows a clear step-by-step plan to do so. And it's there for the taking if you're bold enough to grab the steering wheel of your life. This is quite a comprehensive book discussing everything from your job transition to your travel, and how to set up your company and manage it without taking too much financial risk. He talks about guarding your time, which I believe is one of the most valuable points in the book. He mentions throughout the book strategies to reduce getting caught up in time-wasting activities such as meetings, spending too much time on email at the wrong times, or wasting time on phone calls. He details out his techniques to keep distracting people on the sidelines while he's living his life and doing the things that his heart desires. This book is an instruction manual for escaping the rat race. It's somewhat of a memoir, and a work in progress, of how he's doing it. He has examples throughout the book of how different people have applied his principles and changed their lives. He included a few people who had kids, which is great because a lot of people will use that excuse as a reason to not be able to do what he's doing. He's so open in the book revealing how he takes care of many personal matters in his life, even down to giving his travel checklist and his preferred brand of underwear, relevant for people who want to travel light. He's probably one of the world's most eligible bachelors. That is, if he's willing to let someone get any time on his calendar? I like him. I'd love to run into him in a coffee shop in a foreign country and have some time to just chat with him. He warns that some people really don't know what to do if they aren't working. This is a vital component of the book. He's going full-force at experiencing life in different cultures and getting involved in many different activities that give him new life experiences and perpetuate more new ways of thinking. It's important to know what to do when you are free. Otherwise you just have a vacuum of time which can feel like a boring retirement, where you're available, but all your friends and family are at work. I'm a writer, so I wasn't interested in setting up another company, but he also addresses intellectual property and its intrinsic value. Despite the fact that I don't want to set up a product-based business, many of his strategies are completely applicable and I've begun to apply the techniques right away. Yesterday, I choose to schedule a quick phone call instead of an in-person meeting when the in-person meeting would have been much more time-consuming, for example. He reminded me that I really need to guard my writing time. I certainly can't spin out books on 4 hours a week, but I could if I were willing to farm out the writing activity. He gave me a whole new appreciation for time and what I do each day of my life. If you're not satisfied with your work, or if you're searching for more ways to expand your income and free up your time, this book will be well worth your time. It's urgent for parents to put their kids in a different situation if they don't want them to get caught up in the same rat race that hasn't been fulfilling for them. If they change their own happiness level, it will certainly inspire their family and everyone they know as well. I love the title--The 4-Hour Workweek. At first it seems so absurd, like how could anyone do that? Yet after I read the book, I have tremendous respect this man who is the architect of his own freedom. And he shares his path for others who want to follow.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2016
S
Verified Purchase
Sweetpea Waterlilly
Belleville, US
★★★★★ 5
Learn to live life now
I am a first time reviewer. I don't know Tim. I only know his book. That there are so many first time reviewers speaks volumes about the book. That said, here is my review: It took a kid to get the grown-ups to acknowledge what everyone knew to be true: the emperor was naked. Tim Ferriss is a kid relative to most other "self-help" authors but, like the young boy in the fable, his simple, uncluttered collection of "information we already know" more explicitly and successfully states the truth: our idea of achievement that requires a slavish obsession with working ourselves into the ground is a naked religion. Success is joy. Few books have the potential to inspire passion and fuel personal revolutions. The 4-Hour Workweek is one of them. This book speaks the common yearning to be liberated from the punishing work habits that our society has convinced us are compulsory for success. In simple, often humorous, terms, Tim Ferriss tells us how most of us lie to ourselves about why and how we work and shows us how we can become free. The modern age promised to bring freedom to humanity. Automation would liberate us from the drudgery of many common tasks, allowing us to complete our work with lightening speed, reserving the rest of our time for leisure. Like millionaires who can afford servants to do the drudgery, the common person would be able to forget the mundane and engage in the profound, to travel, to explore, and most importantly, to be free of worry. Unfortunately, we humans forgot about freedom and became slaves to our machines. Machines increased productivity and the availability of things. We reacted by convincing ourselves that we had to have them all to be satisfied and so became slaves to the jobs we believed necessary to obtain those things. More recently, email and cell phones, which were intended to increase productivity and communication, did so by making us instantly accessible and required us to be instantly responsive at any time of the day or night. Cable television and the Internet also increased communications and the flow of information, but also resulted in an information bombardment that left us catatonic, unable to disengage, yet unable to absorb it all. The result? At the end of our working lives - many times not by our own choice but because of downsizing and outsourcing -- exhausted and demoralized, we cannot enjoy the delayed gratification that has been our beacon of light, our holy grail, for so many years. Tim Ferris has the audacity to set the whole paradigm on fire in order to illuminate its true nature. Tim questions our assumptions about what progress is and what progress has done for us by highlighting the terrific costs we have imposed on ourselves. With gleeful delight Tim opens our eyes to the fact that we have become the cyborgs, less human rather than more. In a clear, step-by-step fashion, he presents elegant concepts and applies them to life in practical ways that have profound results. He reminds us that "the opposite of happiness is not sadness but boredom" and employs Pareto's 80/20 principle to demonstrate how we can identify those aspects of our lives that hold us back from being happy. He urges us to understand that life is not about the acquisition of things for later enjoyment, life is about happiness, fulfillment in the present, rather than in some un-promised future. Unfettered by useless jargon and overly academic presentation, Tim demonstrates how we can return to sanity and achieve happiness by finally becoming masters over the technology that was supposed to free us. He challenges us to give ourselves permission to quit the rat race and rejoin the human race. These ideas are not entirely new, but Tim's particular expression of them is like sparkling water to the parched souls of millions who now labor incessantly to achieve success yet yearn to quench their thirst for freedom. You don't have to be a millionaire to live a millionaire lifestyle, Tim says. Do you have a dream? Live it now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 17, 2007

recommand products