
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 4 - Jul 9
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD9 , His tagProduct Specification Species Human Synonyms 5H9 antigen, Cell growth inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility related protein (MRP 1), Tetraspanin 29 (Tspan 29), p24, MIC3, TSPAN29 Accession P21926 Amino Acid Sequence Protein sequence(P21926, Ser112 Ile195, with C 10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11.
Product Specification
| Species | Human |
| Synonyms | 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein (MRP-1), Tetraspanin-29 (Tspan-29), p24, MIC3, TSPAN29 |
| Accession | P21926 |
| Amino Acid Sequence | Protein sequence(P21926, Ser112-Ile195, with C-10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.3kDa Actual:10kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD9 is a cell surface glycoprotein that consists of four transmembrane regions and has two extracellular loops that contain disulfide bonds which are conserved throughout the tetraspanin family. Also containing distinct palmitoylation sites that allows CD9 to interact with lipids and other proteins. CD9 is commonly used as a marker for exosomes as it is contained on their surface. CD9 has a diverse role in cellular processes as it has also been shown to trigger platelet activation and aggregation. CD9 can also modulate cell adhesion[24] and migration.[25][26] This function makes CD9 of interest when studying cancer and cancer metastasis. However, it seems CD9 has a varying role in different types of cancers. Studies showed that CD9 expression levels have an inverse correlation to metastatic potential or patient survival.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.5 ★★★★★
Based on 293 reviews
Sort
Product Reviews
★★★★★ 5
Dog loves it! Squeaky on both ends!
Bungee rope is not as resistant as I wished, but its fun nonetheless!
Squeaks in head and tail. Misssteped the tail and broke one squeaker, still fun though!
Toy can handle a beating. Really happy with it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2022
★★★★★ 5
My dogs loves this toy
I got a few different toys for them today. I need to go through their toybox and get rid of some of the older ones. I can tell the youngster loves the toys. He has taken them into one of the crates and sat with them. Then he brought them back out. He fell asleep with his head against one of them. He has been playing tug of war with this one. And the older one has been running around with it too. Pup already pulled one eye off of this one. But the toy is intact.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2020
★★★★★ 3
SPOT Bungee Raccoon
Purchased 5/20. Decent dog toy. I have a Chiyorkie and he chews on his toys constantly. The squeakers went after a couple of days and then he pulled them out. I put them in the trash. After about two months he had chewed off the head and pulled the bungee out. The bungee went in the trash. I let him play with head and tail pieces for a while but the head had gotten into bad shape so in the trash it went. That left about a twelve inch piece left. He has been playing with that now about a month. He loved tearing the toy up and I do not really blame the toy. He rips up anything that is made of cloth. The only real issue I have with the toy is the two squeakers. IMO they could cause a choking or bowel blocking hazard. I just happened to catch him chewing on them after he had gotten them back. An old knotted on each end knee sock works just about as well but from then on don't leave your socks laying around. They will be fair game for you pet. lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 26, 2020
★★★★★ 4
Fun but.... doesnt stand up to hard play
A very fun toy. My dog loved it - short term. The bungee broke on Day 1 from pulling. (It is designed to be a tug toy, so I assume it should have lasted longer). After a couple weeks, my dog had pulled it apart. Super fun toy, but not for hard play.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 11, 2024
★★★★★ 5
Durable against many rounds of zoomies
Strong bungee cord for sure, and my pup really likes pulling on it and playing tug with it. Originally bought it to encourage him away from underwear and socks, which almost worked. He likes chewing on the feet of the raccoon, so they’ve come off, but the lack of stuffing is wonderful. This is one of the longer lasting toys he’s had, and he’s had it for a couple of months, with its functionality still 100%. This seems to be almost like a toy within a toy, as you’ll still have the band when the rest is gone. Worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2021