Human IgG1 Fc
SKU: 15084136073

Human IgG1 Fc

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 4 - Jul 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG1 FcProduct Specification Species Human Synonyms Ig gamma 1 chain C region, Ig gamma 1 chain C region EU, Ig gamma 1 chain C region KOL, Ig gamma 1 chain C region NIE, IGHG1 Accession P01857 Amino Acid Sequence Protein sequence(P01857, Asp104 Lys330(D239E,L241E), no tag)

Product Specification


Species Human
Synonyms Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1
Accession P01857
Amino Acid Sequence

Protein sequence(P01857, Asp104-Lys330(D239E,L241E), no tag) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight Theoretical:25.5kDa Actual:30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag N/A
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 15084136073

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 2291 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jenna
Lowell, US
★★★★★ 5
absolutely must buy perfect for dogs. I have a large black lab and he has had so much fun with us.
Size: Large Size 3, Color: White-Blue
I have to say that my dog would be considered an aggressive tower. However, this ball has stayed intact. I love that it comes with the pump. It’s extremely functional very soft for catching can be cleaned. Very easy easy the quality is exceptional. Very functional does have a bounce. I can say he has had so much fun with this since it’s getting it for his birthday on 11/11 I highly recommend this product and would definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 23, 2025
K
Verified Purchase
KLBlake
Pawtucket, US
★★★★★ 5
Perfect for keep-away
Size: Large Size 3, Color: Red-Blue
I purchased one of these for my pup and he has a ball throwing it up in the air and chasing it. Handy for something they can play with alone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
S
Verified Purchase
Stacey Prunty
Alexandria, US
★★★★★ 5
Good toy for dogs
Size: Large Size 3, Color: White-Blue
Bought this for our husky. Thought it would be bigger but it’s a good size for her. She has not managed to tear it apart after having it for a few months.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
E
Verified Purchase
Elizabeth Raiola
Birmingham, US
★★★★★ 5
Puppy proof!
Size: Large Size 3, Color: White-Blue
Purchased the blue ball. Puppy loves to carry and shake the ball with the strapes in her mouth. Lots of bite marks but hasnt popped it. We bought 2. She plays in her fenced in yard with them. Fun to throw and kick around.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026
E
Verified Purchase
Erin Bryant
Massapequa, US
★★★★★ 5
Great Toy For Playful Pup
Size: Medium Size 2, Color: White-Blue
We have purchased three of these! Our dog is obsessed with them and they keep her very entertained. The strap is a great tool for her to easily pick up the ball.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026

recommand products